BLASTP 2.2.4 [Aug-26-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.
Query= DG47 amino acid sequence, forward frame 1 (63 letters)
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF 1,052,821 sequences; 333,266,617 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value gi|21392848|ref|NP_652928.1| (NC_003980) lethal factor [Bac... 120 4e-27 gi|10956354|ref|NP_052803.1| (NC_001496) pXO1-107 [Bacillus... 120 4e-27 gi|16031489|emb|CAC93932.1| (AJ413934) Lef protein [Bacillu... 120 5e-27 gi|16974824|pdb|1J7N|B Chain B, Anthrax Toxin Lethal Factor... 119 6e-27
>gi|21392848|ref|NP_652928.1| (NC_003980) lethal factor [Bacillus anthracis str. A2012] gi|20520235|gb|AAM26117.1| (AE011190) lethal factor [Bacillus anthracis str. A2012] Length = 809 Score = 120 bits (301), Expect = 4e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 60 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY Sbjct: 451 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 510 Query: 61 SIS 63 SIS Sbjct: 511 SIS 513
>gi|10956354|ref|NP_052803.1| (NC_001496) pXO1-107 [Bacillus anthracis] gi|126154|sp|P15917|LEF_BACAN Lethal factor precursor (LF) (Anthrax lethal toxin endopeptidase component) gi|80063|pir||JQ0032 anthrax toxin lethal factor pXO1-107 precursor - Bacillus anthracis virulence plasmid pXO1 gi|143142|gb|AAA22569.1| (M30210) lethal factor precursor [Bacillus anthracis] gi|143144|gb|AAA79216.1| (M29081) lethal factor precursor [Bacillus anthracis] gi|4894323|gb|AAD32411.1|AAD32411 (AF065404) pXO1-107 [Bacillus anthracis] Length = 809 Score = 120 bits (301), Expect = 4e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 60 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY Sbjct: 451 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 510 Query: 61 SIS 63 SIS Sbjct: 511 SIS 513
>gi|16031489|emb|CAC93932.1| (AJ413934) Lef protein [Bacillus anthracis] gi|16031491|emb|CAC93933.1| (AJ413935) Lef protein [Bacillus anthracis] Length = 781 Score = 120 bits (300), Expect = 5e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 60 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY Sbjct: 423 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 482 Query: 61 SIS 63 SIS Sbjct: 483 SIS 485
>gi|16974824|pdb|1J7N|B Chain B, Anthrax Toxin Lethal Factor gi|16974823|pdb|1J7N|A Chain A, Anthrax Toxin Lethal Factor gi|16974829|pdb|1JKY|A Chain A, Crystal Structure Of The Anthrax Lethal Factor (Lf): Wild- Type Lf Complexed With The N-Terminal Sequence Of Mapkk2 Length = 776 Score = 119 bits (299), Expect = 6e-27 Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 60 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY Sbjct: 418 NIDALLHQSIGSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKY 477 Query: 61 SIS 63 SIS Sbjct: 478 SIS 480
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF Posted date: Sep 16, 2002 10:25 PM Number of letters in database: 333,266,617 Number of sequences in database: 1,052,821 Lambda K H 0.315 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,293,084 Number of Sequences: 1052821 Number of extensions: 1222478 Number of successful extensions: 2430 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 2425 Number of HSP's gapped (non-prelim): 8 length of query: 63 length of database: 333,266,617 effective HSP length: 39 effective length of query: 24 effective length of database: 292,206,598 effective search space: 7012958352 effective search space used: 7012958352 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 65 (29.6 bits)
